PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT14186
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 205aa    MW: 22798.7 Da    PI: 4.1292
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT14186genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM29.12.9e-09130160333
       NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleev 33 
               p +rFhPtdeelv++yL++kv+gk+l++ee 
  EMT14186 130 PVYRFHPTDEELVTFYLRRKVAGKSLSIEEE 160
               668**********************887654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5018111.114150IPR001810F-box domain
SuperFamilySSF813834.58E-12247IPR001810F-box domain
PfamPF006469.5E-11240IPR001810F-box domain
Gene3DG3DSA:1.20.1280.503.6E-9234No hitNo description
SMARTSM002564.4E-8343IPR001810F-box domain
PROSITE profilePS5100510.99128205IPR003441NAC domain
SuperFamilySSF1019413.53E-8128158IPR003441NAC domain
PfamPF023658.1E-7130178IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 205 aa     Download sequence    Send to blast
MDLPDELLAD VLRRVPPKRL AACRCVCKDW RATIDGHGLV LSHNARWDDT CLFSRVMPSN  60
GGIDTRLASA PSLLSSCIVI DHCNGLLLCT SDNVAKAEMS AMEMEMLISD EKVVLGGSGD  120
EEEEDDVVLP VYRFHPTDEE LVTFYLRRKV AGKSLSIEEE WPDAVPDLKQ ESAHAFVDLE  180
ERESADTVAD FEEESADAVL VDFER
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703062e-58HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLR7W3921e-148R7W392_AEGTA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP119138129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.23e-08NAC domain containing protein 35